PDB entry 3hvc

View 3hvc on RCSB PDB site
Description: Crystal structure of human p38alpha MAP kinase
Class: transferase
Keywords: TRANSFERASE, MAP KINASE, SERINE/THREONINE-PROTEIN KINASE, P38, ISOFORM-2, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism
Deposited on 2009-06-15, released 2009-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hvca_
  • Heterogens: GG5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hvcA (A:)
    gpmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrp
    fqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivk
    cqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdde
    mtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrl
    vgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkrit
    aaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeem
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hvcA (A:)
    rptfyrqelnktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihakr
    tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivltddhvqfli
    yqilrglkyihsadiihrdlkpsnlavnedcelkildfgtrwyrapeimlnwmhynqtvd
    iwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqm
    pkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydq
    sfesrdllidewksltydevisfvppp