PDB entry 3hv6

View 3hv6 on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with RL39
Class: Transferase
Keywords: DFG-out, Type II, RL39, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2009-06-15, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hv6a_
  • Heterogens: BOG, R39, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hv6A (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hv6A (A:)
    erptfyrqelnktiwevperyqnlspvgssvcaafdtktglrvavkklsrpfqsiihakr
    tyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkkltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildfgvatrwyrapeimlnwmhyn
    qtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqs
    ltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvad
    pydqsfesrdllidewksltydevisfvppp