PDB entry 3hv5

View 3hv5 on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with RL24
Class: Transferase
Keywords: DFG-out, Type II, RL24, quinoline-pyrazolourea, hybrid, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2009-06-15, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hv5a_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hv5b_
  • Heterogens: R24, BOG, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hv5A (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hv5A (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglavatrwyrapei
    mlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisse
    sarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhd
    pddepvadpydqsfesrdllidewksltydevisfvppp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hv5B (B:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hv5B (B:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglavatrwyrapei
    mlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisse
    sarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhd
    pddepvadpydqsfesrdllidewksltydevisfvppp