PDB entry 3hv3

View 3hv3 on RCSB PDB site
Description: Human p38 MAP Kinase in Complex with RL49
Class: Transferase
Keywords: DFG-out, Type II, RL49, quinoline-pyrazolourea, hybrid, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-06-15, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered (118)
      • engineered (161)
      • engineered (326)
    Domains in SCOPe 2.06: d3hv3a_
  • Heterogens: R49, BOG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hv3A (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglcrhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqslesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hv3A (A:)
    erptfyrqelnktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivksqkltddh
    vqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfgvatrwyrapeimlnwm
    hynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarny
    iqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddep
    vadpydqslesrdllidewksltydevisfvpppl