PDB entry 3hv0

View 3hv0 on RCSB PDB site
Description: Tryptophanyl-tRNA synthetase from Cryptosporidium parvum
Class: ligase
Keywords: tRNA-ligase, ATP-binding, Aminoacyl-tRNA synthetase, Ligase, Nucleotide-binding, Protein biosynthesis, Structural Genomics, Medical Structural Genomics of Pathogenic Protozoa, MSGPP
Deposited on 2009-06-15, released 2009-06-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.229
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Cryptosporidium parvum Iowa II [TaxId:353152]
    Gene: cgd7_1490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3hv0a_
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Cryptosporidium parvum Iowa II [TaxId:353152]
    Gene: cgd7_1490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3hv0b_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hv0A (A:)
    gpgsmpwevkadnaygidynklidkfgcklitkdmiermerltgqkahhffrrniflshr
    dfekildvyekgelfylytgrgpsseslhvghlvpflftkylqdtfkvplviqltddekf
    ifksnltleethnyayenmkdiiacgfdpeltfiftnleyiaelypdilriekkiscsqi
    ksifgfkdscnvgkfafpavqaapafsssfphifggrtdihclvphaidqdpyfrmvrdv
    aprlgylkpssihsiflpslqgsqtkmsasvqnssifvndneesirnkimkyafsggqat
    eeeqrrlganldvdvswqylrflmeddekleeigkkyssgemlsgeiksilvqelvkltk
    nhqknreainddviakftnksreqllklfinkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hv0A (A:)
    nklidkfgcklitkdmiermerltgqkahhffrrniflshrdfekildvyekgelfylyt
    grgpsseslhvghlvpflftkylqdtfkvplviqltddekfifksnltleethnyayenm
    kdiiacgfdpeltfiftnleyiaelypdilriekkiscsqiksifgfkdscnvgkfafpa
    vqaapafsssfphifggrtdihclvphaidqdpyfrmvrdvaprlgylkpssihsiflps
    nssifvndneesirnkimkyafsggqateeeqganldvdvswqylrflmeddekleeigk
    kyssgemlsgeiksilvqelvkltknhqknreainddviakftnksreqllk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hv0B (B:)
    gpgsmpwevkadnaygidynklidkfgcklitkdmiermerltgqkahhffrrniflshr
    dfekildvyekgelfylytgrgpsseslhvghlvpflftkylqdtfkvplviqltddekf
    ifksnltleethnyayenmkdiiacgfdpeltfiftnleyiaelypdilriekkiscsqi
    ksifgfkdscnvgkfafpavqaapafsssfphifggrtdihclvphaidqdpyfrmvrdv
    aprlgylkpssihsiflpslqgsqtkmsasvqnssifvndneesirnkimkyafsggqat
    eeeqrrlganldvdvswqylrflmeddekleeigkkyssgemlsgeiksilvqelvkltk
    nhqknreainddviakftnksreqllklfinkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hv0B (B:)
    nklidkfgcklitkdmiermerltgqkahhffrrniflshrdfekildvyekgelfylyt
    grgpsseslhvghlvpflftkylqdtfkvplviqltddekfifksnltleethnyayenm
    kdiiacgfdpeltfiftnleyiaelypdilriekkiscsqiksifgfkdscnvgkfafpa
    vqaapafsssfphifggrtdihclvphaidqdpyfrmvrdvaprlgylkpssihsiflps
    nssifvndneesirnkimkyafsggqateeeqganldvdvswqylrflmeddekleeigk
    kyssgemlsgeiksilvqelvkltknhqknreainddviakftnksreqllk