PDB entry 3hum

View 3hum on RCSB PDB site
Description: Crystal structure of Penicillin binding protein 4 from Staphylococcus aureus COL in complex with Cefotaxime
Class: HYDROLASE/Antibiotics
Keywords: Penicillin binding protein 4, Cefotaxime, beta-lactamase, Serine type D-Ala, D-Ala-carboxypeptidase, Antibiotics, HYDROLASE-Antibiotics complex
Deposited on 2009-06-15, released 2009-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein 4
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: PBP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HI26
      • engineered (210)
    Domains in SCOPe 2.08: d3huma1, d3huma2
  • Chain 'B':
    Compound: Penicillin-binding protein 4
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: PBP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HI26
      • engineered (210)
    Domains in SCOPe 2.08: d3humb1, d3humb2
  • Heterogens: CEW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3humA (A:)
    mgsshhhhhhssglvprgshmamknlisiiiilcltlsimtpyaqatnsdvtpvqaanqy
    gyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyltleavnkgqlsldd
    tvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaalilakkvskntsdf
    vdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqertvttardyaildlhvike
    tpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssdtanynhtittkrgk
    frinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskgeqringkkyyvend
    lydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhqpiiqkantvaksmwe
    ehplftiiggtclvaglalivhmiinrlfrkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3humA (A:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3humB (B:)
    mgsshhhhhhssglvprgshmamknlisiiiilcltlsimtpyaqatnsdvtpvqaanqy
    gyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyltleavnkgqlsldd
    tvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaalilakkvskntsdf
    vdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqertvttardyaildlhvike
    tpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssdtanynhtittkrgk
    frinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskgeqringkkyyvend
    lydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevhqpiiqkantvaksmwe
    ehplftiiggtclvaglalivhmiinrlfrkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3humB (B:)
    tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
    tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
    lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrsfaptkykdqertvtt
    ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
    tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqykyvkilskg
    eqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdygpptvevh