PDB entry 3hui

View 3hui on RCSB PDB site
Description: Crystal Structure of the mutant A105R of [2Fe-2S] Ferredoxin in the Class I CYP199A2 System from Rhodopseudomonas palustris
Class: electron transport
Keywords: cytochrome P450, ferredoxin, rhodopseudomonas palustris, electron transfer, Iron, Iron-sulfur, Metal-binding, ELECTRON TRANSPORT
Deposited on 2009-06-14, released 2010-02-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N2U2 (20-125)
      • expression tag (14-19)
      • engineered (125)
    Domains in SCOPe 2.05: d3huia_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3huiA (A:)
    mgsshhhhhhssglvprgshmakinfvdhtgetrtveveegatvmeaairnaipgveaec
    ggacacatchvyvdeawrekvggpspmeedmldfgydvrpnsrlscqikvsneldglivt
    tperqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3huiA (A:)
    vprgshmakinfvdhtgetrtveveegatvmeaairnaipgveaecggacacatchvyvd
    eawrekvggpspmeedmldfgydvrpnsrlscqikvsneldglivttperqr