PDB entry 3htz

View 3htz on RCSB PDB site
Description: Crystal Structure of the catalytic fragment of alanyl-tRNA synthetase in complex with L-serine: Re-refined
Class: ligase
Keywords: Adenosine Triphosphate, Alanine-tRNA Ligase, Binding Sites, Genetic Code, Protein Conformation, Aminoacyl-tRNA synthetase, ATP-binding, Cytoplasm, Ligase, Nucleotide-binding, Protein biosynthesis
Deposited on 2009-06-12, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.253
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: ALAS, AQ_1293
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67323 (0-452)
      • expression tag (453-456)
    Domains in SCOPe 2.07: d3htza1, d3htza2, d3htza3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3htzA (A:)
    slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
    atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
    pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
    eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeidi
    ifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirrilr
    ramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkagm
    eyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqceleeq
    rerarkhfkveakkvkpvyshlkelgktsafvgaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3htzA (A:)
    slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
    atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
    pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
    eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeidi
    ifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirrilr
    ramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkagm
    eyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqceleeq
    rerarkpvyshlkelgktsafvgaaal