PDB entry 3htq

View 3htq on RCSB PDB site
Description: the hemagglutinin structure of an avian H1N1 influenza A virus in complex with LSTc
Class: viral protein
Keywords: receptor, VIRAL PROTEIN
Deposited on 2009-06-12, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.218
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/WDK/JX/12416/2005(H1N1)) [TaxId:666057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3htqa_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus (A/WDK/JX/12416/2005(H1N1)) [TaxId:666057]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HTQ (0-159)
    Domains in SCOPe 2.07: d3htqb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3htqA (A:)
    dticigyhannstdtvdtvleknvtvthsvnllednhngklcklngiaplqlgkcnvagw
    llgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssferfeifpka
    sswpnhettkgvtaacsyfgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvh
    hppttseqqtlyqntdayvsvgsskynrrftpeiaarpkvrgqagrmnyywtlldqgdti
    tfeatgnliapwyafalnkgsdsgiitsdapvhncdtkcqtphgainstlpfqnvhpiti
    gecpkyvkstklrmatglrnipsi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3htqB (B:)
    glfgamagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsiiekmn
    tqftavgkefnnlerrienlnkkvddgfldvwtynaellvllenertldfhdsnvrnlye
    kvksqlrnnakeigngcfefyhkcddecmesvkngtydyp