PDB entry 3hsy

View 3hsy on RCSB PDB site
Description: High resolution structure of a dimeric GluR2 N-terminal domain (NTD)
Class: transport protein
Keywords: glutamate receptor, ligand-gated ion channel, synapse, cell junction, cell membrane, endoplasmic reticulum, glycoprotein, ion transport, ionic channel, lipoprotein, membrane, palmitate, phosphoprotein, postsynaptic cell membrane, receptor, RNA editing, transmembrane, transport, transport protein
Deposited on 2009-06-11, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.178
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hsya_
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hsyb_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hsyA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hsyA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninrrvildcerdkvndivdqvi
    tigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivdyddslvskfierwstleeke
    ypgahtatikytsaltydavqvmteafrnlrkqrieisrrgnagdclanpavpwgqgvei
    eralkqvqveglsgnikfdqngkrinytinimelktngprkigywsevdkmvvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hsyB (B:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtlt