PDB entry 3hsw

View 3hsw on RCSB PDB site
Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with 2-methoxycyclohexa-2-5-diene-1,4-dione
Class: Hydrolase
Keywords: Hydrolase, Curcumin binding, PLA2, Pancreatic Enzyme, Disulfide bond, Lipid degradation, Lipoprotein, Metal-binding, Palmitate, Pyrrolidone carboxylic acid, Secreted
Deposited on 2009-06-11, released 2009-06-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3hswa_
  • Heterogens: MCW, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hswA (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc