PDB entry 3hsq

View 3hsq on RCSB PDB site
Description: Structural Basis for the Sugar Nucleotide and Acyl Chain Selectivity of Leptospira interrogans LpxA
Class: transferase
Keywords: L.interrogans LPXA, LPXA, LPXA crystal structure, Acyltransferase, Lipid A biosynthesis, Lipid synthesis, Transferase
Deposited on 2009-06-10, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Leptospira interrogans [TaxId:173]
    Gene: LA3949, LA_3949, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hsqa_
  • Chain 'B':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Leptospira interrogans [TaxId:173]
    Gene: LA3949, LA_3949, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hsqb_
  • Chain 'C':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: Leptospira interrogans [TaxId:173]
    Gene: LA3949, LA_3949, lpxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hsqc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hsqA (A:)
    mkihptaiidpkaelhesvevgpysiiegnvsiqegtiieghvkicagseigkfnrfhqg
    avigvmpqdlgfnqqlltktvigdhnifreysnihkgtkedsptvignknyfmgnshvgh
    dcilgnnnilthgavlaghvtlgnfafisglvavhqfcfvgdysmvaglakvvqdvppys
    tvdgnpstvvglnsvgmkragfspevrnaikhaykviyhsgistrkaldeleasgnlieq
    vkyiikffrdsdrgvtnhr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hsqB (B:)
    mkihptaiidpkaelhesvevgpysiiegnvsiqegtiieghvkicagseigkfnrfhqg
    avigvmpqdlgfnqqlltktvigdhnifreysnihkgtkedsptvignknyfmgnshvgh
    dcilgnnnilthgavlaghvtlgnfafisglvavhqfcfvgdysmvaglakvvqdvppys
    tvdgnpstvvglnsvgmkragfspevrnaikhaykviyhsgistrkaldeleasgnlieq
    vkyiikffrdsdrgvtnhr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hsqC (C:)
    mkihptaiidpkaelhesvevgpysiiegnvsiqegtiieghvkicagseigkfnrfhqg
    avigvmpqdlgfnqqlltktvigdhnifreysnihkgtkedsptvignknyfmgnshvgh
    dcilgnnnilthgavlaghvtlgnfafisglvavhqfcfvgdysmvaglakvvqdvppys
    tvdgnpstvvglnsvgmkragfspevrnaikhaykviyhsgistrkaldeleasgnlieq
    vkyiikffrdsdrgvtnhr