PDB entry 3hsj

View 3hsj on RCSB PDB site
Description: Crystal structure of E. coli HPPK(N55A)
Class: transferase
Keywords: alpha beta, ATP-binding, Folate biosynthesis, Kinase, Nucleotide-binding, Transferase
Deposited on 2009-06-10, released 2010-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hppk
  Species: Escherichia coli [TaxId:83333]
  Gene: b0142, foIK, folK, JW0138
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
    • engineered (54)
  Domains in SCOPe 2.08: d3hsja_
• Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hsjA (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylaaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw