PDB entry 3hsb

View 3hsb on RCSB PDB site
Description: Crystal structure of YmaH (Hfq) from Bacillus subtilis in complex with an RNA aptamer
Class: RNA binding protein/RNA
Keywords: Sm-like motif, Protein-RNA complex, RNA-binding, Stress response, RNA BINDING PROTEIN-RNA COMPLEX
Deposited on 2009-06-10, released 2010-06-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ymaH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ymaH
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ymaH
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ymaH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3hsbd_
  • Chain 'E':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ymaH
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Protein hfq
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ymaH
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: RNA (5'-r(*ap*gp*ap*gp*ap*gp*a)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hsbD (D:)
    gplgsmkpiniqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliy
    khaistfapqknvqlele
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hsbD (D:)
    niqdqflnqirkentyvtvfllngfqlrgqvkgfdnftvllesegkqqliykhaistfap
    qknvqle
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'X':
    No sequence available.