PDB entry 3hrv

View 3hrv on RCSB PDB site
Description: Crystal structure of TcpA, a Type IV pilin from Vibrio cholerae El Tor biotype
Class: cell adhesion
Keywords: Type IV pili, pilin, Vibrio cholerae, toxin-coregulated pilus, microcolonies, colonization, virulence factor, CELL ADHESION
Deposited on 2009-06-09, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toxin coregulated pilin
    Species: Vibrio cholerae [TaxId:666]
    Gene: tcpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60153 (21-191)
      • expression tag (18-20)
    Domains in SCOPe 2.07: d3hrva1, d3hrva2
  • Chain 'B':
    Compound: Toxin coregulated pilin
    Species: Vibrio cholerae [TaxId:666]
    Gene: tcpa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hrvb_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hrvA (A:)
    mgsshhhhhhssglvprgshmdsqnmtkaaqnlnsvqiamtqtyrslgnypatananaat
    qlanglvslgkvsadeaknpftgtamgifsfprnsaankafaitvggltqaqcktlvtsv
    gdmfpfinvkegafaavadlgdfetsvadaatgagviksiapgsanlnltnithveklct
    gtapftvafgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hrvA (A:)
    shmdsqnmtkaaqnlnsvqiamtqtyrslgnypatananaatqlanglvslgkvsadeak
    npftgtamgifsfprnsaankafaitvggltqaqcktlvtsvgdmfpfinvkegafaava
    dlgdfetsvadaatgagviksiapgsanlnltnithveklctgtapftvafgns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hrvB (B:)
    mgsshhhhhhssglvprgshmdsqnmtkaaqnlnsvqiamtqtyrslgnypatananaat
    qlanglvslgkvsadeaknpftgtamgifsfprnsaankafaitvggltqaqcktlvtsv
    gdmfpfinvkegafaavadlgdfetsvadaatgagviksiapgsanlnltnithveklct
    gtapftvafgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hrvB (B:)
    sqnmtkaaqnlnsvqiamtqtyrslgnypatananaatqlanglvslgkvsadeaknpft
    gtamgifsfprnsaankafaitvggltqaqcktlvtsvgdmfpfinvkegafaavadlgd
    fetsvadaatgagviksiapgsanlnltnithveklctgtapftvafgns