PDB entry 3hrl

View 3hrl on RCSB PDB site
Description: crystal structure of a putative endonuclease-like protein (ngo0050) from neisseria gonorrhoeae
Deposited on 2009-06-09, released 2009-06-30
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease-Like Protein
    Species: Neisseria gonorrhoeae FA 1090 [TaxId:242231]
    Gene: NGO0050
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5FAH0 (4-End)
      • expression tag (2-3)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3hrlA (A:)
snamseaeaklwqhlragrlngykfrrqqpmgnyivdfmcvtpkliveadggqhaeqavy
dhartvylnslgftvlrfwnheilqqtndvlaeilrvlqelekq

    Sequence, based on observed residues (ATOM records):
    >3hrlA (A:)
amseaeaklwqhlragrlngykfrrqqpmgnyivdfmcvtpkliveadgvydhartvyln
slgftvlrfwnheilqqtndvlaeilrvlqelek