PDB entry 3hrd

View 3hrd on RCSB PDB site
Description: Crystal structure of nicotinate dehydrogenase
Class: oxidoreductase
Keywords: Selenium ligand, 2Fe-2S, Iron, Iron-sulfur, Metal-binding, OXIDOREDUCTASE
Deposited on 2009-06-09, released 2009-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinate dehydrogenase large molybdopterin subunit
    Species: Eubacterium barkeri [TaxId:1528]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nicotinate dehydrogenase medium molybdopterin subunit
    Species: Eubacterium barkeri [TaxId:1528]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nicotinate dehydrogenase FAD-subunit
    Species: Eubacterium barkeri [TaxId:1528]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Nicotinate dehydrogenase small FeS subunit
    Species: Eubacterium barkeri [TaxId:1528]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0QLF3 (0-156)
      • expression tag (157-159)
    Domains in SCOPe 2.06: d3hrdd1, d3hrdd2, d3hrdd3
  • Chain 'E':
    Compound: Nicotinate dehydrogenase large molybdopterin subunit
    Species: Eubacterium barkeri [TaxId:1528]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nicotinate dehydrogenase medium molybdopterin subunit
    Species: Eubacterium barkeri [TaxId:1528]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Nicotinate dehydrogenase FAD-subunit
    Species: Eubacterium barkeri [TaxId:1528]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Nicotinate dehydrogenase small FeS subunit
    Species: Eubacterium barkeri [TaxId:1528]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hrdh1, d3hrdh2
  • Heterogens: SE, NO3, MG, MOS, MCN, NIO, FAD, FES, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hrdD (D:)
    mnkitinlnlngearsivtepnkrlldllredfgltsvkegcsegecgactvifngdpvt
    tccmlagqadestiitlegvaedgkpsllqqcfleagavqcgyctpgmiltakalldknp
    dptdeeitvamsgnlcrctgyikihaavryavercanaaa
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3hrdH (H:)
    mnkitinlnlngearsivtepnkrlldllredfgltsvkegcsegecgactvifngdpvt
    tccmlagqadestiitlegvaedgkpsllqqcfleagavqcgyctpgmiltakalldknp
    dptdeeitvamsgnlcrctgyikihaavryavercanaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hrdH (H:)
    mnkitinlnlngearsivtepnkrlldllredfgltsvkegcsegecgactvifngdpvt
    tccmlagqadestiitlegvaedgkpsllqqcfleagavqcgyctpgmiltakalldknp
    dptdeeitvamsgnlcrctgyikihaavryavercan