PDB entry 3hrb

View 3hrb on RCSB PDB site
Description: p38 kinase Crystal structure in complex with small molecule inhibitor
Class: transferase
Keywords: p38 MAP KINASE, TRANSFERASE, INHIBITOR COMPLEX, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase
Deposited on 2009-06-09, released 2009-09-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hrba_
  • Heterogens: I39, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hrbA (A:)
    sqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqs
    iihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqk
    ltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtg
    yvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgt
    pgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaq
    alahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hrbA (A:)
    erptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyvatrwy
    rapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellk
    kissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayf
    aqyhdpddepvadpydqsfesrdllidewksltydevisfvppp