PDB entry 3hqx
View 3hqx on RCSB PDB site
Description: Crystal structure of protein of unknown function (DUF1255,PF06865) from Acinetobacter sp. ADP1
Class: structural genomics, unknown function
Keywords: DUF1255,PF06865,PSI2,MCSG, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, unknown function
Deposited on
2009-06-08, released
2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.165
AEROSPACI score: 0.59
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: UPF0345 protein ACIAD0356
Species: Acinetobacter sp. ADP1 [TaxId:62977]
Gene: ACIAD0356
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3hqxa_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3hqxA (A:)
snamssaqfdhvtvikksnvyfgglcishtvqfedgtkktlgvilpteqpltfethvper
meiisgecrvkiadsteselfragqsfyvpgnslfkietdevldyvchleg
Sequence, based on observed residues (ATOM records): (download)
>3hqxA (A:)
saqfdhvtvikksnvyfgglcishtvqfedgtkktlgvilpteqpltfethvpermeiis
gecrvkiadsteselfragqsfyvpgnslfkietdevldyvchle