PDB entry 3hqx

View 3hqx on RCSB PDB site
Description: Crystal structure of protein of unknown function (DUF1255,PF06865) from Acinetobacter sp. ADP1
Class: structural genomics, unknown function
Keywords: DUF1255,PF06865,PSI2,MCSG, Structural Genomics, Protein Structure Initiative, Midwest Center for Structural Genomics, unknown function
Deposited on 2009-06-08, released 2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.165
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0345 protein ACIAD0356
    Species: Acinetobacter sp. ADP1 [TaxId:62977]
    Gene: ACIAD0356
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hqxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hqxA (A:)
    snamssaqfdhvtvikksnvyfgglcishtvqfedgtkktlgvilpteqpltfethvper
    meiisgecrvkiadsteselfragqsfyvpgnslfkietdevldyvchleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hqxA (A:)
    saqfdhvtvikksnvyfgglcishtvqfedgtkktlgvilpteqpltfethvpermeiis
    gecrvkiadsteselfragqsfyvpgnslfkietdevldyvchle