PDB entry 3hqn

View 3hqn on RCSB PDB site
Description: Apo crystal structure of Leishmania mexicana(LmPYK)pyruvate kinase
Class: Transferase
Keywords: TIM BARREL, T-STATE ENZYME, Transferase, Allosteric enzyme, ATP-binding, Glycolysis, Kinase, Magnesium, Metal-binding, Nucleotide-binding, Pyruvate
Deposited on 2009-06-08, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • see remark 999 (382)
      • see remark 999 (389)
      • see remark 999 (404-405)
    Domains in SCOPe 2.07: d3hqna1, d3hqna2, d3hqna3
  • Chain 'D':
    Compound: pyruvate kinase
    Species: Leishmania mexicana [TaxId:5665]
    Gene: PYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27686 (Start-498)
      • see remark 999 (382)
      • see remark 999 (389)
      • see remark 999 (404-405)
    Domains in SCOPe 2.07: d3hqnd1, d3hqnd2, d3hqnd3
  • Heterogens: GOL, SO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hqnA (A:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hqnA (A:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    ayanqtrillve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hqnD (D:)
    msqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgshey
    hqttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkg
    tkdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnl
    pgcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiicki
    enhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqml
    esmtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalne
    yvffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpiv
    cvttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvi
    hadhkvkgyanqtrillve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hqnD (D:)
    sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
    qttinnvrqaaaelgvniaialdtkgpeirtgqfvggdavmergatcyvttdpafadkgt
    kdkfyidyqnlskvvrpgnyiyiddgililqvqshedeqtlectvtnshtisdrrgvnlp
    gcdvdlpavsakdrvdlqfgveqgvdmifasfirsaeqvgdvrkalgpkgrdimiickie
    nhqgvqnidsiieesdgimvargdlgveipaekvvvaqkiliskcnvagkpvicatqmle
    smtynprptraevsdvanavfngadcvmlsgetakgkypnevvqymaricleaqsalney
    vffnsikklqhipmsadeavcssavnsvyetkakamvvlsntgrsarlvakyrpncpivc
    vttrlqtcrqlnitqgvesvffdadklghdegkehrvaagvefakskgyvqtgdycvvih
    adhanqtrillve