PDB entry 3hqc

View 3hqc on RCSB PDB site
Description: Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1 domain-containing phosphatase (TENC1)
Class: hydrolase
Keywords: Human Tensin-like C1 domain-containing phosphatase, TENC1, Phosphotyrosine Binding Domain, PTB, TNS2, KIAA1075, STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, NEW YORK SGX Research Center for Structural Genomics, NYSGXRC, Cell junction, Cell membrane, Hydrolase, Membrane, Metal-binding, Phorbol-ester binding, Phosphoprotein, Protein phosphatase, SH2 domain, Zinc-finger
Deposited on 2009-06-05, released 2009-07-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tensin-like C1 domain-containing phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA1075, TENC1, TNS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63HR2 (3-End)
      • engineered (143)
    Domains in SCOPe 2.01: d3hqca_
  • Heterogens: SO4, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hqcA (A:)
    mslstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvhfkvsa
    qgitltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenv
    chlfaeldpdqpagaivtfitkvmlgqrkeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hqcA (A:)
    staadllrqgaacsvlyltsvetesltgpqavarassaalscstpavvhfkvsaqgitlt
    dnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenvchlfae
    ldpdqpagaivtfitkvmlg