PDB entry 3hqa

View 3hqa on RCSB PDB site
Description: Crystal structure of human desarg-C5A
Class: immune system
Keywords: COMPLEMENT, C5A, ANAPHYLATOXIN, Cleavage on pair of basic residues, Complement alternate pathway, Complement pathway, Cytolysis, Disulfide bond, Glycoprotein, Immune response, Inflammatory response, Innate immunity, Membrane attack complex, Secreted, IMMUNE SYSTEM
Deposited on 2009-06-05, released 2010-02-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C5
    Species: Homo sapiens [TaxId:9606]
    Gene: C5, CPAMD4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01031 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d3hqaa_
  • Chain 'B':
    Compound: Complement C5
    Species: Homo sapiens [TaxId:9606]
    Gene: C5, CPAMD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3hqab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3hqaA (A:)
mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lranishkdmqlg

    Sequence, based on observed residues (ATOM records): (download) 
    >3hqaA (A:)
mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lranis

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3hqaB (B:)
mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lranishkdmqlg

    Sequence, based on observed residues (ATOM records): (download) 
    >3hqaB (B:)
qkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasqlr
anis