PDB entry 3hpm

View 3hpm on RCSB PDB site
Description: oxidized dimeric pick1 pdz c46g mutant in complex with the carboxyl tail peptide of glur2
Deposited on 2009-06-04, released 2010-06-09
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PRKCA-binding protein,9-mer peptide of THE GLUR2 SUBUNIT
    Species: synthetic construct, synthetic [TaxId:32630]
    Gene: PICK1, rCG_60080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GQQ2 (4-95)
      • expression tag (3)
      • engineered mutation (31)
    • PDB 3HPM (96-110)
  • Chain 'B':
    Compound: PRKCA-binding protein,9-mer peptide of THE GLUR2 SUBUNIT
    Species: synthetic construct, synthetic [TaxId:32630]
    Gene: PICK1, rCG_60080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GQQ2 (4-95)
      • expression tag (0-3)
      • engineered mutation (31)
    • PDB 3HPM (96-110)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3hpmA (A:)
ggsgvpgkvtlqkdaqnligisigggaqycpglyivqvfdntpaaldgtvaagdeitgvn
grsikgktkvevakmiqevkgevtihynklqadpkqlevlfngpgiesvki

    Sequence, based on observed residues (ATOM records):
    >3hpmA (A:)
gvpgkvtlqkdaqnligisigggaqycpglyivqvfdntpaaldgtvaagdeitgvngrs
ikgktkvevakmiqevkgevtihynklqadpkqlevlfngpgiesvki

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3hpmB (B:)
ggsgvpgkvtlqkdaqnligisigggaqycpglyivqvfdntpaaldgtvaagdeitgvn
grsikgktkvevakmiqevkgevtihynklqadpkqlevlfngpgiesvki