PDB entry 3hpi

View 3hpi on RCSB PDB site
Description: Crystal structure of maltose-binding protein mutant with bound sucrose
Class: sugar binding protein
Keywords: sugar binding protein, periplasmic binding protein, MBP, Sugar transport, Transport
Deposited on 2009-06-04, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b4034, JW3994, malE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-371)
      • engineered (15-16)
      • engineered (63)
      • engineered (112)
    Domains in SCOPe 2.07: d3hpia_
  • Chain 'B':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: b4034, JW3994, malE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-371)
      • engineered (15-16)
      • engineered (63)
      • engineered (112)
    Domains in SCOPe 2.07: d3hpib_
  • Heterogens: ZN, SUC, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hpiA (A:)
    gakieegklviwinglfgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpd
    iifyahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavyalsliyn
    kdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydi
    kdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidts
    kvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkp
    lgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd
    ealkdaqtritk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hpiA (A:)
    ieegklviwinglfgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiif
    yahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavyalsliynkdl
    lpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdv
    gvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvn
    ygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplga
    valksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdeal
    kdaqtritk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hpiB (B:)
    gakieegklviwinglfgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpd
    iifyahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavyalsliyn
    kdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydi
    kdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidts
    kvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkp
    lgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvd
    ealkdaqtritk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hpiB (B:)
    ieegklviwinglfgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiif
    yahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavyalsliynkdl
    lpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdv
    gvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvn
    ygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplga
    valksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdeal
    kdaqtritk