PDB entry 3hp2

View 3hp2 on RCSB PDB site
Description: Crystal Structure of Human p38alpha complexed with a pyridinone compound
Class: Transferase
Keywords: two lobes, two ligands, two binding sites, ATP site and distal site, peptide flip, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2009-06-03, released 2009-09-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2, THP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3hp2a_
  • Heterogens: P36, I46, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hp2A (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hp2A (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglvatrwyrapeim
    lnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisses
    arnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdp
    ddepvadpydqsfesrdllidewksltydevisfvpppldq