PDB entry 3hp0

View 3hp0 on RCSB PDB site
Description: Crystal structure of a Putative polyketide biosynthesis enoyl-CoA hydratase (pksH) from Bacillus subtilis
Class: lyase
Keywords: polyketide synthase, enoyl CoA hydratase,isomerase,Antibiotic biosynthesis,11251f,PSI2,NYSGXRC, Lyase, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics
Deposited on 2009-06-03, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.232
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17160, pksH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hp0a_
  • Chain 'B':
    Compound: Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17160, pksH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hp0b_
  • Chain 'C':
    Compound: Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17160, pksH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hp0c_
  • Chain 'D':
    Compound: Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17160, pksH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hp0d_
  • Chain 'E':
    Compound: Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17160, pksH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hp0e_
  • Chain 'F':
    Compound: Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU17160, pksH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hp0f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hp0A (A:)
    mslvtyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglp
    evfcfgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvs
    atdiaiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewgl
    idafdaesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpq
    nqmgiiryvetgqfpwedqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hp0A (A:)
    tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
    fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
    aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
    daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
    iiryvetgqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hp0B (B:)
    mslvtyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglp
    evfcfgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvs
    atdiaiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewgl
    idafdaesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpq
    nqmgiiryvetgqfpwedqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hp0B (B:)
    tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
    fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
    aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
    daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
    iiryvetgqfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hp0C (C:)
    mslvtyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglp
    evfcfgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvs
    atdiaiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewgl
    idafdaesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpq
    nqmgiiryvetgqfpwedqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hp0C (C:)
    tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
    fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
    aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
    daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
    iiryvetgqfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hp0D (D:)
    mslvtyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglp
    evfcfgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvs
    atdiaiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewgl
    idafdaesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpq
    nqmgiiryvetgqfpwedqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hp0D (D:)
    tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
    fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
    aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
    daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
    iiryvetgqfp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hp0E (E:)
    mslvtyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglp
    evfcfgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvs
    atdiaiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewgl
    idafdaesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpq
    nqmgiiryvetgqfpwedqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hp0E (E:)
    tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
    fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
    aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
    daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
    iiryvetgqfp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3hp0F (F:)
    mslvtyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglp
    evfcfgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvs
    atdiaiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewgl
    idafdaesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpq
    nqmgiiryvetgqfpwedqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hp0F (F:)
    tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
    fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
    aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
    daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
    iiryvetgqfp