PDB entry 3hop

View 3hop on RCSB PDB site
Description: Structure of the actin-binding domain of human filamin A
Class: Structural Protein
Keywords: Calponin homology domain, actin binding domain, Acetylation, Actin-binding, Alternative splicing, Cytoplasm, Cytoskeleton, Disease mutation, Phosphoprotein, Polymorphism, Structural Protein
Deposited on 2009-06-03, released 2009-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.252
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hopa1, d3hopa2
  • Chain 'B':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hopb1, d3hopb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hopA (A:)
    gamassshsragqsaagaapgggvdtrdaempatekdlaedapwkkiqqntftrwcnehl
    kcvskrianlqtdlsdglrliallevlsqkkmhrkhnqrptfrqmqlenvsvalefldre
    siklvsidskaivdgnlklilgliwtlilhysismpmwdeeedeeakkqtpkqrllgwiq
    nklpqlpitnfsrdwqsgralgalvdscapglcpdwdswdaskpvtnareamqqaddwlg
    ipqvitpeeivdpnvdehsvmtylsqfpkakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hopA (A:)
    edapwkkiqqntftrwcnehlkcvskrianlqtdlsdglrliallevlsqkkmhrkhnqr
    ptfrqmqlenvsvalefldresiklvsidskaivdgnlklilgliwtlilhysismpmwa
    kkqtpkqrllgwiqnklpqlpitnfsrdwqsgralgalvdscapglcpdwdswdaskpvt
    nareamqqaddwlgipqvitpeeivdpnvdehsvmtylsqfpkakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hopB (B:)
    gamassshsragqsaagaapgggvdtrdaempatekdlaedapwkkiqqntftrwcnehl
    kcvskrianlqtdlsdglrliallevlsqkkmhrkhnqrptfrqmqlenvsvalefldre
    siklvsidskaivdgnlklilgliwtlilhysismpmwdeeedeeakkqtpkqrllgwiq
    nklpqlpitnfsrdwqsgralgalvdscapglcpdwdswdaskpvtnareamqqaddwlg
    ipqvitpeeivdpnvdehsvmtylsqfpkakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hopB (B:)
    apwkkiqqntftrwcnehlkcvskrianlqtdlsdglrliallevlsqkkmhrkhnqrpt
    frqmqlenvsvalefldresiklvsidskaivdgnlklilgliwtlilhysismpmwdee
    edeeakkqtpkqrllgwiqnklpqlpitnfsrdwqsgralgalvdscapglcpdwdswda
    skpvtnareamqqaddwlgipqvitpeeivdpnvdehsvmtylsqfpkakl