PDB entry 3hoi

View 3hoi on RCSB PDB site
Description: crystal structure of fmn-dependent nitroreductase bf3017 from bacteroides fragilis nctc 9343 (yp_212631.1) from bacteroides fragilis nctc 9343 at 1.55 a resolution
Deposited on 2009-06-02, released 2009-06-23
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FMN-dependent nitroreductase BF3017
    Species: Bacteroides fragilis NCTC 9343 [TaxId:272559]
    Gene: BF3017, YP_212631.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LB10 (1-192)
      • leader sequence (0)
  • Heterogens: FMN, UNL, SO4, FLC, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3hoiA (A:)
gaertiqlpkpdmnragllmkalserhstreyaskalsntdlsdllwaanginrssegkr
tapsamnrqdidiyvvlpqgtylydakghklnlisegdhrsavaggqafvnnapvslvlv
sdlsklgdaksnhvqlmgamdagivsqnislfcsaarlatvprasmdlvrlkaalklkdt
qmpmmnhpvgyfk