PDB entry 3hoh

View 3hoh on RCSB PDB site
Description: ribonuclease t1 (thr93gln mutant) complexed with 2'gmp
Class: hydrolase
Keywords: hydrolase, endoribonuclease, ribonuclease, endonuclease
Deposited on 1998-09-11, released 1998-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.167
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (ribonuclease t1)
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • engineered (92)
  Domains in SCOPe 2.08: d3hoha_
• Chain 'B':
  Compound: protein (ribonuclease t1)
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • engineered (92)
  Domains in SCOPe 2.08: d3hohb_
• Chain 'C':
  Compound: protein (ribonuclease t1)
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • engineered (92)
  Domains in SCOPe 2.08: d3hohc_
• Chain 'D':
  Compound: protein (ribonuclease t1)
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • engineered (92)
  Domains in SCOPe 2.08: d3hohd_
• Heterogens: CA, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hohA (A:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithqgasgnnfvect
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hohB (B:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithqgasgnnfvect
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hohC (C:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithqgasgnnfvect
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hohD (D:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithqgasgnnfvect