PDB entry 3hnt

View 3hnt on RCSB PDB site
Description: CS-35 Fab complex with a linear, terminal oligoarabinofuranosyl tetrasaccharide from lipoarabinomannan
Class: immune system
Keywords: antibody-carbohydrate complex, oligofuranoside, tuberculosis, immune system
Deposited on 2009-06-01, released 2009-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CS-35 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HNT (0-219)
  • Chain 'L':
    Compound: CS-35 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HNT (0-213)
    Domains in SCOPe 2.06: d3hntl1, d3hntl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hntL (L:)
    diqmtqttsslsaslgdrvtigcrasqdigsylnwyqqkpdgavrlliyytsrlhsgvps
    rfsgsgsgthfsltisnleqedigtyfchqdtkppytfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec