PDB entry 3hns

View 3hns on RCSB PDB site
Description: CS-35 Fab Complex with Oligoarabinofuranosyl Hexasaccharide
Class: immune system
Keywords: antibody-carbohydrate complex, oligofuranoside, tuberculosis, immune system
Deposited on 2009-06-01, released 2009-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: CS-35 Fab Heavy Chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3HNS (0-219)
• Chain 'L':
  Compound: CS-35 Fab Light Chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 3HNS (0-213)
  Domains in SCOPe 2.07: d3hnsl1, d3hnsl2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hnsL (L:)
  diqmtqttsslsaslgdrvtigcrasqdigsylnwyqqkpdgavrlliyytsrlhsgvps
  rfsgsgsgthfsltisnleqedigtyfchqdtkppytfgsgtkleikradaaptvsifpp
  sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
  ltkdeyerhnsytceathktstspivksfnrnec