PDB entry 3hnk

View 3hnk on RCSB PDB site
Description: Crystal structure of the dimeric assembly of the cyt cb562 variant RIDC-1
Class: metal binding protein
Keywords: Electron transport, METAL BINDING PROTEIN
Deposited on 2009-05-31, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnka_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnkb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hnkA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hnkB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr