PDB entry 3hni

View 3hni on RCSB PDB site
Description: Crystal structure of the Zn-induced tetramer of the engineered cyt cb562 variant RIDC-1
Class: metal binding protein
Keywords: Electron transport, METAL BINDING PROTEIN
Deposited on 2009-05-31, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.229
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnia_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnib_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnic_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnid_
  • Chain 'E':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnie_
  • Chain 'F':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnif_
  • Chain 'G':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnig_
  • Chain 'H':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (33)
      • engineered (37)
      • engineered (40-41)
      • engineered (58)
      • engineered (65)
      • engineered (68)
      • engineered (72)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3hnih_
  • Heterogens: HEM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hniA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hniB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hniC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hniD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hniE (E:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hniF (F:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hniG (G:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hniH (H:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqaaaeqlkttcnachqkyr