PDB entry 3hnh

View 3hnh on RCSB PDB site
Description: Crystal Structure of PqqC Active Site Mutant Y175S,R179S in complex with a reaction intermediate
Class: oxidoreductase
Keywords: PqqC, PQQ biosynthesis, oxidase, complex, all helical, OXIDOREDUCTASE
Deposited on 2009-05-31, released 2010-05-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrroloquinoline-quinone synthase
    Species: Klebsiella pneumoniae subsp. pneumoniae [TaxId:272620]
    Gene: PQQC
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6T9H1 (Start-250)
      • engineered mutation (174)
      • engineered mutation (178)
      • expression tag (251-252)
    Domains in SCOPe 2.06: d3hnha1, d3hnha2
  • Heterogens: AHQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hnhA (A:)
    mlitdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplk
    daaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpg
    vrfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfsfrssl
    sqanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvt
    dkaawhttrlvlehhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hnhA (A:)
    litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd
    aaimancpdaqtrrkwvqrildhdgsdggieawlrlgeavglsrddllserhvlpgvrfa
    vdaylnfarracwqeaacssltelfapqhypwikeegyfsfrsslsqanrdvehglalak
    aycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtdkaawhttrlvle