PDB entry 3hnb

View 3hnb on RCSB PDB site
Description: Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal structure of complex between factor VIII C2 domain and an inhibitor
Class: blood clotting
Keywords: small molecule inhibitor/blood clotting, blood clotting
Deposited on 2009-05-31, released 2010-01-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.187
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: coagulation factor viii
    Species: Homo sapiens [TaxId:9606]
    Gene: F8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hnbm_
  • Heterogens: 768, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download) 
    >3hnbM (M:)
dlnscsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkew
lqvdfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqds
ftpvvnsldpplltrylrihpqswvhqialrmevlgcea

    Sequence, based on observed residues (ATOM records): (download) 
    >3hnbM (M:)
scsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqv
dfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftp
vvnsldpplltrylrihpqswvhqialrmevlgcea