PDB entry 3hmw

View 3hmw on RCSB PDB site
Description: Crystal structure of ustekinumab FAB
Class: immune system
Keywords: ustekinumab, cnto1275, il-12, il-23, antibody, fab, monoclonal antibody, immune system
Deposited on 2009-05-29, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: ustekinumab fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HMW (0-End)
  • Chain 'L':
    Compound: ustekinumab fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3HMW (0-213)
    Domains in SCOPe 2.07: d3hmwl1, d3hmwl2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3hmwL (L:)
diqmtqspsslsasvgdrvtitcrasqgisswlawyqqkpekapksliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqyniypytfgqgtkleikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec