PDB entry 3hmr

View 3hmr on RCSB PDB site
Description: Crystal structure of the N-terminal fragment (31-127) of the mouse hepatocyte growth factor/scatter factor
Class: hormone
Keywords: HGF/SF, hormone/growth factor, Disulfide bond, Glycoprotein, Growth factor, Kringle, Pyrrolidone carboxylic acid, Serine protease homolog, HORMONE
Deposited on 2009-05-29, released 2010-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte growth factor
    Species: Mus musculus [TaxId:10090]
    Gene: Hgf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3hmra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3hmrA (A:)
gsegqkkrrntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckaf
vfdksrkrcywypfnsmssgvkkgfghefdlyenkdyir

    Sequence, based on observed residues (ATOM records): (download) 
    >3hmrA (A:)
ntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkrc
ywypfnsmssgvkkgfghefdlyenkdyir