PDB entry 3hmi

View 3hmi on RCSB PDB site
Description: The crystal structure of human ABL2 in complex with 5-AMINO-3-{[4-(AMINOSULFONYL)PHENYL]AMINO}-N-(2,6-DIFLUOROPHENYL)-1H-1,2,4-TRIAZOLE-1-CARBOTHIOAMIDE
Class: transferase
Keywords: Tyrosine kinase, ABL, ABL2, Abelson murine leukemia viral oncogene, ATP-binding, Cell adhesion, Cytoskeleton, Kinase, Lipoprotein, Magnesium, Manganese, Metal-binding, Myristate, Nucleotide-binding, Phosphoprotein, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2009-05-29, released 2009-07-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.19
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3hmia_
  • Heterogens: DKI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hmiA (A:)
    mghhhhhhssgvdlgtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltv
    avktlkedtmeveeflkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylr
    ecnreevtavvllymatqissameylekknfihrdlaarnclvgenhvvkvadfglsrlm
    tgdtytahagakfpikwtapeslayntfsiksdvwafgvllweiatygmspypgidlsqv
    ydllekgyrmeqpegcppkvyelmracwkwspadrpsfaethqafetmfhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hmiA (A:)
    dkwemertditmkhklgggqygevyvgvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctleppfyivteympygnlldylrecnreevtavvllymatqissame
    ylekknfihrdlaarnclvgenhvvkvadfglsrlmtgdtytahagakfpikwtapesla
    yntfsiksdvwafgvllweiatygmspypgidlsqvydllekgyrmeqpegcppkvyelm
    racwkwspadrpsfaethqafetmfhds