PDB entry 3hmf

View 3hmf on RCSB PDB site
Description: Crystal Structure of the second Bromodomain of Human Poly-bromodomain containing protein 1 (PB1)
Class: transcription
Keywords: PB1, polybromo 1 isoform 1, BAF180, Polybromo-1D, PBRM1, BRG1-associated factor 180, Bromodomain, Chromatin regulator, DNA-binding, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2009-05-29, released 2009-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.172
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein polybromo-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PB1, PBRM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86U86 (2-115)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3hmfa1, d3hmfa2
  • Heterogens: ZN, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hmfA (A:)
    smspaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlktiaq
    riqngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhe