PDB entry 3hmc

View 3hmc on RCSB PDB site
Description: Endolysin from Bacillus anthracis
Class: hydrolase
Keywords: endolysin, glycosyl hydrolase, Hydrolase
Deposited on 2009-05-29, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.207
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative prophage LambdaBa04, glycosyl hydrolase, family 25
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS0460, BA_0485, GBAA0485, GBAA_0485
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81YZ2 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3hmca1, d3hmca2
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hmcA (A:)
    gshmghiidiskwngdinwsiakqhidfiiarvqdgsnyvdplykgyvqamkqhgipfgn
    yafcrfvsiadakkeaqdfwnrgdksatvwvadvevktmndmragtqafidelyrlgakk
    vglyvghhmytpfgmanvksdfvwipryggnkpaypcdiwqytetgnvpgigkcdlnsli
    gnkslswftesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hmcA (A:)
    shmghiidiskwngdinwsiakqhidfiiarvqdgsnyvdplykgyvqamkqhgipfgny
    afcrfvsiadakkeaqdfwnrgdksatvwvadvevktmndmragtqafidelyrlgakkv
    glyvghhmytpfgmanvksdfvwipryggnkpaypcdiwqytetgnvpgigkcdlnslig
    nkslswfte