PDB entry 3hlt

View 3hlt on RCSB PDB site
Description: The crystal structure of human haloacid dehalogenase-like hydrolase domain containing 2 (HDHD2)
Class: hydrolase
Keywords: HDHD2, haloacid dehalogenase-like hydrolase domain containing 2, Structural Genomics, Structural Genomics Consortium, SGC, HYDROLASE
Deposited on 2009-05-28, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hdhd2
    Species: Homo sapiens [TaxId:9606]
    Gene: Hdhd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0R4 (Start-258)
      • expression tag (259)
    Domains in SCOPe 2.07: d3hlta1, d3hlta2
  • Chain 'C':
    Compound: hdhd2
    Species: Homo sapiens [TaxId:9606]
    Gene: Hdhd2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hltc_
  • Heterogens: SO4, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hltA (A:)
    maacralkavlvdlsgtlhiedaavpgaqealkrlrgasviirfvtnttkeskqdllerl
    rklefdisedeiftsltaarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglape
    hfhyqilnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkp
    ektfflealrgtgcepeeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinppp
    yltcesfphavdhilqhllaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hltA (A:)
    ralkavlvdlsgtlhiedaavpgaqealkrlrgasviirfvtnttkeskqdllerlrkle
    fdisedeiftsltaarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhy
    qilnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektf
    flealrgtgcepeeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltc
    esfphavdhilqhlla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hltC (C:)
    maacralkavlvdlsgtlhiedaavpgaqealkrlrgasviirfvtnttkeskqdllerl
    rklefdisedeiftsltaarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglape
    hfhyqilnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkp
    ektfflealrgtgcepeeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinppp
    yltcesfphavdhilqhllaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hltC (C:)
    alkavlvdlsgtvpgaqealkrlviirfvtnttkeskqdllerlrklefdisedeiftsl
    taarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhyqilnqafrllld
    gapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektfflealrgtgcep
    eeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltcesfphavdhilq
    hll