PDB entry 3hlp

View 3hlp on RCSB PDB site
Description: Carboxypeptidase A liganded to an organic small-molecule: conformational changes
Class: hydrolase
Keywords: alpha-beta hydrolase, protein-ligand complex, zinc-dependent protease, Carboxypeptidase, HYDROLASE
Deposited on 2009-05-28, released 2010-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.158
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxypeptidase A1 (Pancreatic)
    Species: Bos taurus [TaxId:9913]
    Gene: CPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hlpa_
  • Chain 'B':
    Compound: Carboxypeptidase A1 (Pancreatic)
    Species: Bos taurus [TaxId:9913]
    Gene: CPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3hlpb_
  • Heterogens: ZN, MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hlpA (A:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hlpA (A:)
    stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
    widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
    nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
    vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs
    iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
    htv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hlpB (B:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hlpB (B:)
    stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
    widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
    nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
    vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs
    iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
    htv