PDB entry 3hlo

View 3hlo on RCSB PDB site
Description: Crystal structure of chemically synthesized 'covalent dimer' [Gly51/D-Ala51']HIV-1 protease
Deposited on 2009-05-27, released 2011-07-27
The last revision was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 'covalent dimer' [Gly51/D-Ala51'] HIV-1 protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3HLO (0-202)
  • Heterogens: 2NC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3hloA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiggfikvrqyd
qipveiaghkaigtvlvgptpvniigrnlltqigatlnfcggggpqitlwkrplvtirig
gqlkealldtgaddtvieelnlpgcwkpkliggiagfikvrqydqipveiaghkaigtvl
vgptpvniigrnlltqigatlnf