PDB entry 3hkp

View 3hkp on RCSB PDB site
Description: Crystal structure determination of Catechol 1,2-Dioxygenase from Rhodococcus opacus 1CP in complex with protocatechuate
Class: oxidoreductase
Keywords: beta-sandwich, Aromatic hydrocarbons catabolism, Dioxygenase, Iron, Metal-binding, Oxidoreductase
Deposited on 2009-05-25, released 2010-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catechol 1,2-dioxygenase
    Species: Rhodococcus opacus [TaxId:37919]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P95607 (Start-279)
      • conflict (119)
    Domains in SCOPe 2.06: d3hkpa_
  • Heterogens: FE, DHB, 6PL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hkpA (A:)
    mtttesptaagsgsaatdkfkaeratadtsperlaaiakdalgalndvilkhgvtypeyr
    vfkqwlidvgeggewplfldvfiehsveevlarsrkgtmgsiegpyyienspelpskctd
    pmreedekitplvfsgqvtdldgnglagakvelwhadndgyysqfaphlpewnlrgtiia
    deegryeittiqpapyqiptdgptgqfieaqnghpwrpahlhlivsapgkesvttqlyfk
    ggewidsdvasatkpelildpktgddgknyvtynfvldpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hkpA (A:)
    atadtsperlaaiakdalgalndvilkhgvtypeyrvfkqwlidvgeggewplfldvfie
    hsveevlarsrkgtmgsiegpyyienspelpskctdpmreedekitplvfsgqvtdldgn
    glagakvelwhadndgyysqfaphlpewnlrgtiiadeegryeittiqpapyqiptdgpt
    gqfieaqnghpwrpahlhlivsapgkesvttqlyfkggewidsdvasatkpelildpktg
    ddgknyvtynfvldpa