PDB entry 3hkf

View 3hkf on RCSB PDB site
Description: Murine unglycosylated IgG Fc fragment
Class: immune system
Keywords: antibody, glycosylation, stability, IMMUNE SYSTEM
Deposited on 2009-05-23, released 2009-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Igh protein
    Species: Mus musculus [TaxId:10090]
    Gene: Igh-4, Igh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99LC4
      • engineered (171)
    Domains in SCOPe 2.07: d3hkfa1, d3hkfa2
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hkfA (A:)
    mevssvfifppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpree
    qfnstfrsvselpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytippp
    keqmakdkvsltcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqk
    snweagntftcsvlheglhnhhtekslshspgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hkfA (A:)
    ssvfifppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtqpreeqfn
    stfrsvselpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytipppkeq
    makdkvsltcmitdffpeditvewqwngqpaenykntqpimdtdgsyfvysklnvqksnw
    eagntftcsvlheglhnhhteksls