PDB entry 3hjx

View 3hjx on RCSB PDB site
Description: Human prion protein variant D178N with V129
Class: membrane protein
Keywords: Prion protein, Cell membrane, Disease mutation, Disulfide bond, Glycoprotein, Golgi apparatus, GPI-anchor, Lipoprotein, Membrane, Polymorphism, Prion, MEMBRANE PROTEIN
Deposited on 2009-05-22, released 2010-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRNP, PRIP, PRP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04156 (0-End)
      • variant (3)
      • engineered (52)
    Domains in SCOPe 2.08: d3hjxa_
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hjxA (A:)
    ggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhncvnitik
    qhtvttttkgenftetdvkmmervveqmcitqyeresqayyqrgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hjxA (A:)
    ggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhncvnitik
    qhtvtttenftetdvkmmervveqmcitqyeresq