PDB entry 3hjw

View 3hjw on RCSB PDB site
Description: Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
Class: isomerase/RNA
Keywords: protein-RNA complex, Box H/ACA, ribonucleoprotein particles, RNP, pseudouridine synthase, pseudouridylase, pseudouridylation, RNA editing, post-transcriptional modification, Isomerase, tRNA processing, Ribonucleoprotein, Ribosome biogenesis, rRNA processing, Ribosomal protein, RNA-binding, ISOMERASE-RNA COMPLEX
Deposited on 2009-05-22, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pseudouridine synthase Cbf5
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1785
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hjwa1, d3hjwa2
  • Chain 'B':
    Compound: Ribosome biogenesis protein Nop10
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1141
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hjwb_
  • Chain 'C':
    Compound: 50S ribosomal protein L7Ae
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1367, rpl7ae
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RNA (58-mer)
  • Chain 'E':
    Compound: 5'-r(*gp*ap*gp*cp*gp*(fhu)p*gp*cp*gp*gp*up*up*u)-3'
  • Heterogens: ZN, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hjwA (A:)
    rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
    kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
    vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
    glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
    ehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsq
    emlektkgiavdvekvfmprdwypklw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hjwB (B:)
    frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.