PDB entry 3hjw

View 3hjw on RCSB PDB site
Description: Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
Class: isomerase/RNA
Keywords: protein-RNA complex, Box H/ACA, ribonucleoprotein particles, RNP, pseudouridine synthase, pseudouridylase, pseudouridylation, RNA editing, post-transcriptional modification, Isomerase, tRNA processing, Ribonucleoprotein, Ribosome biogenesis, rRNA processing, Ribosomal protein, RNA-binding, ISOMERASE-RNA COMPLEX
Deposited on 2009-05-22, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pseudouridine synthase Cbf5
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1785
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7LWY0 (0-326)
  Domains in SCOPe 2.07: d3hjwa1, d3hjwa2
• Chain 'B':
  Compound: Ribosome biogenesis protein Nop10
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1141
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U1R4 (0-52)
  Domains in SCOPe 2.07: d3hjwb_
• Chain 'C':
  Compound: 50S ribosomal protein L7Ae
  Species: Pyrococcus furiosus [TaxId:2261]
  Gene: PF1367, rpl7ae
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U160 (0-119)
• Chain 'D':
  Compound: RNA (58-mer)
  
• Chain 'E':
  Compound: 5'-r(*gp*ap*gp*cp*gp*(fhu)p*gp*cp*gp*gp*up*up*u)-3'
  
• Heterogens: ZN, K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hjwA (A:)
  rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
  kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
  vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
  glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
  ehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsq
  emlektkgiavdvekvfmprdwypklw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hjwB (B:)
  frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.