PDB entry 3hjw
View 3hjw on RCSB PDB site
Description: Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
Class: isomerase/RNA
Keywords: protein-RNA complex, Box H/ACA, ribonucleoprotein particles, RNP, pseudouridine synthase, pseudouridylase, pseudouridylation, RNA editing, post-transcriptional modification, Isomerase, tRNA processing, Ribonucleoprotein, Ribosome biogenesis, rRNA processing, Ribosomal protein, RNA-binding, ISOMERASE-RNA COMPLEX
Deposited on
2009-05-22, released
2009-06-23
The last revision prior to the SCOPe 2.06 freeze date was dated
2015-08-12, with a file datestamp of
2015-08-07.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pseudouridine synthase Cbf5
Species: Pyrococcus furiosus [TaxId:2261]
Gene: PF1785
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3hjwa1, d3hjwa2 - Chain 'B':
Compound: Ribosome biogenesis protein Nop10
Species: Pyrococcus furiosus [TaxId:2261]
Gene: PF1141
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3hjwb_ - Chain 'C':
Compound: 50S ribosomal protein L7Ae
Species: Pyrococcus furiosus [TaxId:2261]
Gene: PF1367, rpl7ae
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: RNA (58-mer)
- Chain 'E':
Compound: 5'-r(*gp*ap*gp*cp*gp*(fhu)p*gp*cp*gp*gp*up*up*u)-3'
- Heterogens: ZN, K, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3hjwA (A:)
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
ehlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsq
emlektkgiavdvekvfmprdwypklw
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3hjwB (B:)
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.