PDB entry 3hjo

View 3hjo on RCSB PDB site
Description: Crystal Structure of Glutathione Transferase Pi Y108V Mutant in Complex with the Glutathione Conjugate of Ethacrynic Acid
Class: transferase
Keywords: TRANSFERASE, glutathione, detoxification, ethacrynic acid, ethacrynic acid-glutathione conjugate
Deposited on 2009-05-22, released 2009-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.16
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase P
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (107)
    Domains in SCOPe 2.08: d3hjoa1, d3hjoa2
  • Chain 'B':
    Compound: Glutathione S-transferase P
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (0-208)
      • engineered (107)
    Domains in SCOPe 2.08: d3hjob1, d3hjob2
  • Heterogens: GSH, EAA, CA, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hjoA (A:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hjoB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq