PDB entry 3hjj

View 3hjj on RCSB PDB site
Description: Crystal Structure of Maltose O-acetyltransferase from Bacillus anthracis
Class: transferase
Keywords: left-handed beta-helix, Acyltransferase, Transferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2009-05-21, released 2009-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose o-acetyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3155, BA_3402, GBAA3402, GBAA_3402, maA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81N16 (3-189)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3hjja1, d3hjja2
  • Chain 'B':
    Compound: maltose o-acetyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3155, BA_3402, GBAA3402, GBAA_3402, maA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hjjb_
  • Chain 'C':
    Compound: maltose o-acetyltransferase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: BAS3155, BA_3402, GBAA3402, GBAA_3402, maA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hjjc_
  • Heterogens: ACY, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hjjA (A:)
    snamktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgss
    adgkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathpl
    hpvernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggn
    pakviktiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hjjA (A:)
    namktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssa
    dgkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplh
    pvernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnp
    akviktiee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hjjB (B:)
    snamktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgss
    adgkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathpl
    hpvernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggn
    pakviktiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hjjB (B:)
    mktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadg
    kaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpv
    ernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpak
    viktiee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hjjC (C:)
    snamktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgss
    adgkaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathpl
    hpvernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggn
    pakviktiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hjjC (C:)
    mktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadg
    kaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpv
    ernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpak
    viktie